Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein automated matches [276310] (3 species) not a true protein |
Species Pseudomonas sp. [311137] (1 PDB entry) |
Domain d1gdga3: 1gdg A:1-132 [302421] automated match to d1kw3b1 complexed with bpy, fe2, no |
PDB Entry: 1gdg (more details), 2 Å
SCOPe Domain Sequences for d1gdga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdga3 d.32.1.3 (A:1-132) automated matches {Pseudomonas sp.} sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa eifhepflpsap
Timeline for d1gdga3: