SCOPe 2.06: Domain d1gdga3: 1gdg A:1-132

Lineage for d1gdga3 (1gdg A:1-132)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein automated matches [276310] (3 species)
   not a true protein

7. Species Pseudomonas sp. [311137] (1 PDB entry)

8. Domain d1gdga3: 1gdg A:1-132 [302421]
   automated match to d1kw3b1
   complexed with bpy, fe2, no

Details for d1gdga3

PDB Entry: 1gdg, 2 Å

PDB Description: crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase in complex with 2,3-dhbp and no

PDB Compounds: (A:) biphenyl-2,3-diol 1,2-dioxygenase

SCOPe Domain Sequences for d1gdga3:

Sequence; same for both SEQRES and ATOM records:

>d1gdga3 d.32.1.3 (A:1-132) automated matches {Pseudomonas sp.}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap

Timeline for d1gdga3:

• d1gdga3 is new in SCOPe 2.06-stable
  
• d1gdga3 appears in SCOPe 2.07
  
• d1gdga3 appears in the current release, SCOPe 2.08