Lineage for d1eula7 (1eul A:344-360,A:600-750)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (42 PDB entries)
    Uniprot P04191
  8. Domain d1eula7: 1eul A:344-360,A:600-750 [302391]
    Other proteins in same PDB: d1eula5, d1eula6, d1eula8
    automated match to d1wpga2
    complexed with ca

Details for d1eula7

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle, adult isoform

SCOPe Domain Sequences for d1eula7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula7 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d1eula7 are not available.

Timeline for d1eula7:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eula5, d1eula6, d1eula8