Lineage for d1eula8 (1eul A:361-599)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. Protein Calcium ATPase [81658] (1 species)
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries)
    Uniprot P04191
  8. Domain d1eula8: 1eul A:361-599 [302392]
    Other proteins in same PDB: d1eula5, d1eula6, d1eula7
    automated match to d1wpga3
    complexed with ca

    has additional insertions and/or extensions that are not grouped together

Details for d1eula8

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle, adult isoform

SCOPe Domain Sequences for d1eula8:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula8 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d1eula8 are not available.

Timeline for d1eula8:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eula5, d1eula6, d1eula7