Lineage for d1eula5 (1eul A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (42 PDB entries)
    Uniprot P04191
  8. Domain d1eula5: 1eul A:1-124,A:240-343,A:751-994 [302389]
    Other proteins in same PDB: d1eula6, d1eula7, d1eula8
    automated match to d1wpga4
    complexed with ca

Details for d1eula5

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle, adult isoform

SCOPe Domain Sequences for d1eula5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula5 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d1eula5 are not available.

Timeline for d1eula5:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eula6, d1eula7, d1eula8