Lineage for d1eula6 (1eul A:125-239)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2406122Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2406123Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 protein domains)
  6. 2406124Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2406125Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
    Uniprot P04191
  8. 2406154Domain d1eula6: 1eul A:125-239 [302390]
    Other proteins in same PDB: d1eula5, d1eula7, d1eula8
    automated match to d1wpga1
    complexed with ca

Details for d1eula6

PDB Entry: 1eul (more details), 2.6 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle, adult isoform

SCOPe Domain Sequences for d1eula6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eula6 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d1eula6:

Click to download the PDB-style file with coordinates for d1eula6.
(The format of our PDB-style files is described here.)

Timeline for d1eula6: