SCOPe 2.08: Domain d1b26e1: 1b26 E:179-412

Lineage for d1b26e1 (1b26 E:179-412)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (8 species)

7. Species Thermotoga maritima [TaxId:2336] [51888] (3 PDB entries)

8. Domain d1b26e1: 1b26 E:179-412 [30236]
   Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2
   has additional insertions and/or extensions that are not grouped together

Details for d1b26e1

PDB Entry: 1b26, 3 Å

PDB Description: glutamate dehydrogenase

PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d1b26e1:

Sequence; same for both SEQRES and ATOM records:

>d1b26e1 c.2.1.7 (E:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg

Timeline for d1b26e1:

• d1b26e1 first appeared (with stable ids) in SCOP 1.55
  
• d1b26e1 appears in SCOPe 2.07