PDB entry 1b26

View 1b26 on RCSB PDB site
Description: glutamate dehydrogenase
Class: oxidoreductase
Keywords: metabolic role, glutamate, dehydrogenase, oxidoreductase
Deposited on 1998-12-04, released 1999-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b26a1, d1b26a2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b26b1, d1b26b2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b26c1, d1b26c2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b26d1, d1b26d2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b26e1, d1b26e2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b26f1, d1b26f2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b26A (A:)
    mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvq
    hnvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnel
    erlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelg
    gskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvav
    sdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaih
    agnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsf
    fwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b26A (A:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b26B (B:)
    mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvq
    hnvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnel
    erlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelg
    gskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvav
    sdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaih
    agnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsf
    fwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b26B (B:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b26C (C:)
    mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvq
    hnvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnel
    erlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelg
    gskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvav
    sdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaih
    agnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsf
    fwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b26C (C:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b26D (D:)
    mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvq
    hnvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnel
    erlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelg
    gskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvav
    sdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaih
    agnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsf
    fwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b26D (D:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b26E (E:)
    mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvq
    hnvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnel
    erlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelg
    gskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvav
    sdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaih
    agnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsf
    fwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b26E (E:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b26F (F:)
    mpekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvq
    hnvargpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnel
    erlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelg
    gskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvav
    sdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaih
    agnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsf
    fwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b26F (F:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg