Lineage for d1gtma1 (1gtm A:181-419)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579636Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1579637Protein Glutamate dehydrogenase [51884] (8 species)
  7. 1579714Species Pyrococcus furiosus [TaxId:2261] [51886] (1 PDB entry)
  8. 1579715Domain d1gtma1: 1gtm A:181-419 [30223]
    Other proteins in same PDB: d1gtma2, d1gtmb2, d1gtmc2
    complexed with so4

Details for d1gtma1

PDB Entry: 1gtm (more details), 2.2 Å

PDB Description: structure of glutamate dehydrogenase
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d1gtma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Pyrococcus furiosus [TaxId: 2261]}
ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh

SCOPe Domain Coordinates for d1gtma1:

Click to download the PDB-style file with coordinates for d1gtma1.
(The format of our PDB-style files is described here.)

Timeline for d1gtma1: