Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein Glutamate dehydrogenase [53225] (8 species) |
Species Pyrococcus furiosus [TaxId:2261] [53227] (1 PDB entry) |
Domain d1gtmc2: 1gtm C:3-180 [33873] Other proteins in same PDB: d1gtma1, d1gtmb1, d1gtmc1 complexed with so4 |
PDB Entry: 1gtm (more details), 2.2 Å
SCOPe Domain Sequences for d1gtmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtmc2 c.58.1.1 (C:3-180) Glutamate dehydrogenase {Pyrococcus furiosus [TaxId: 2261]} adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
Timeline for d1gtmc2:
View in 3D Domains from other chains: (mouse over for more information) d1gtma1, d1gtma2, d1gtmb1, d1gtmb2 |