SCOPe 2.08: Domain d1evya2: 1evy A:9-197

Lineage for d1evya2 (1evy A:9-197)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (7 PDB entries)

8. Domain d1evya2: 1evy A:9-197 [30215]
   Other proteins in same PDB: d1evya1
   complexed with mys

Details for d1evya2

PDB Entry: 1evy, 1.75 Å

PDB Description: crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase

PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1evya2:

Sequence; same for both SEQRES and ATOM records:

>d1evya2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
drsfvcwat

Timeline for d1evya2:

• d1evya2 first appeared (with stable ids) in SCOP 1.55
  
• d1evya2 appears in SCOPe 2.07