Lineage for d1evya2 (1evy A:9-188)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (6 proteins) 
Protein Glycerol-3- phosphate dehydrogenase [51881] (1 species) Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (2 PDB entries) 
Domain d1evya2: 1evy A:9-188 [30215]
Other proteins in same PDB: d1evya1
Details for d1evya2
PDB Entry: 1evy (more details), 1.75 Å
PDB Description: crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase
SCOP Domain Sequences for d1evya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evya2 c.2.1.6 (A:9-188) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana)}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
SCOP Domain Coordinates for d1evya2:
Click to download the PDB-style file with coordinates for d1evya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1evya2:
- d1evya2 appears in SCOP 1.57
- d1evya2 appears in the current release, SCOPe 2.08
View in 3D
