| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (18 species) |
| Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries) |
| Domain d1llda1: 1lld A:7-149 [30177] Other proteins in same PDB: d1llda2, d1lldb2 complexed with nad |
PDB Entry: 1lld (more details), 2 Å
SCOPe Domain Sequences for d1llda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg
Timeline for d1llda1: