Lineage for d1lldb1 (1lld B:7-149)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579093Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries)
  8. 1579095Domain d1lldb1: 1lld B:7-149 [30178]
    Other proteins in same PDB: d1llda2, d1lldb2
    complexed with nad

Details for d1lldb1

PDB Entry: 1lld (more details), 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1lldb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lldb1 c.2.1.5 (B:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg

SCOPe Domain Coordinates for d1lldb1:

Click to download the PDB-style file with coordinates for d1lldb1.
(The format of our PDB-style files is described here.)

Timeline for d1lldb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lldb2