SCOP 1.63: Domain d1mlda1: 1mld A:1-144

Lineage for d1mlda1 (1mld A:1-144)

Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)
Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
Protein Malate dehydrogenase [51849] (11 species)
Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
Domain d1mlda1: 1mld A:1-144 [30122]
Other proteins in same PDB: d1mlda2, d1mldb2, d1mldc2, d1mldd2

Details for d1mlda1

PDB Entry: 1mld (more details), 1.9 Å

PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases

SCOP Domain Sequences for d1mlda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa)}
akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
nstipitaevfkkhgvynpnkifg

SCOP Domain Coordinates for d1mlda1:

Click to download the PDB-style file with coordinates for d1mlda1.
(The format of our PDB-style files is described here.)

Timeline for d1mlda1: