Lineage for d4ph0c1 (4ph0 C:1-126)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330931Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2330932Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2331173Family a.73.1.0: automated matches [227254] (1 protein)
    not a true family
  6. 2331174Protein automated matches [227039] (3 species)
    not a true protein
  7. 2331175Species Bovine leukemia virus [TaxId:11901] [273631] (3 PDB entries)
  8. 2331182Domain d4ph0c1: 4ph0 C:1-126 [300219]
    Other proteins in same PDB: d4ph0a2, d4ph0b2, d4ph0c2, d4ph0d2, d4ph0e2, d4ph0f2
    automated match to d4ph0a1

Details for d4ph0c1

PDB Entry: 4ph0 (more details), 2.75 Å

PDB Description: capsid protein from bovine leukemia virus
PDB Compounds: (C:) BLV capsid

SCOPe Domain Sequences for d4ph0c1:

Sequence, based on SEQRES records: (download)

>d4ph0c1 a.73.1.0 (C:1-126) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqy
iaspvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqa
wknlpt

Sequence, based on observed residues (ATOM records): (download)

>d4ph0c1 a.73.1.0 (C:1-126) automated matches {Bovine leukemia virus [TaxId: 11901]}
piisegnrhrawalrelqdikkeienkapgsqvwiqtlrlailqadptpadleqlcqyia
spvdqtahmtsltaaiaaaeaantlqgfnpqngtltqqsaqpnagdlrsqyqnlwlqawk
nlpt

SCOPe Domain Coordinates for d4ph0c1:

Click to download the PDB-style file with coordinates for d4ph0c1.
(The format of our PDB-style files is described here.)

Timeline for d4ph0c1: