Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (12 species) not a true protein |
Species Bovine leukemia virus [TaxId:11901] [273638] (1 PDB entry) |
Domain d4ph0d2: 4ph0 D:133-205 [273639] Other proteins in same PDB: d4ph0a1, d4ph0b1, d4ph0c1, d4ph0d1, d4ph0e1, d4ph0f1 automated match to d1qrja1 |
PDB Entry: 4ph0 (more details), 2.75 Å
SCOPe Domain Sequences for d4ph0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ph0d2 a.28.3.0 (D:133-205) automated matches {Bovine leukemia virus [TaxId: 11901]} wstivqgpaesyvefvnrlqisladnlpdgvpkepiidslsyanankecqqilqgrglva apvgqklqacahw
Timeline for d4ph0d2: