Lineage for d4ph0d2 (4ph0 D:133-205)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319355Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2319709Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2319801Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2319802Protein automated matches [191156] (12 species)
    not a true protein
  7. 2319803Species Bovine leukemia virus [TaxId:11901] [273638] (1 PDB entry)
  8. 2319807Domain d4ph0d2: 4ph0 D:133-205 [273639]
    Other proteins in same PDB: d4ph0a1, d4ph0b1, d4ph0c1, d4ph0d1, d4ph0e1, d4ph0f1
    automated match to d1qrja1

Details for d4ph0d2

PDB Entry: 4ph0 (more details), 2.75 Å

PDB Description: capsid protein from bovine leukemia virus
PDB Compounds: (D:) BLV capsid

SCOPe Domain Sequences for d4ph0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ph0d2 a.28.3.0 (D:133-205) automated matches {Bovine leukemia virus [TaxId: 11901]}
wstivqgpaesyvefvnrlqisladnlpdgvpkepiidslsyanankecqqilqgrglva
apvgqklqacahw

SCOPe Domain Coordinates for d4ph0d2:

Click to download the PDB-style file with coordinates for d4ph0d2.
(The format of our PDB-style files is described here.)

Timeline for d4ph0d2: