![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein ADP-L-glycero-D-mannoheptose 6-epimerase [51761] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51762] (1 PDB entry) |
![]() | Domain d1eq2d_: 1eq2 D: [29817] complexed with adq, nap has additional subdomain(s) that are not in the common domain |
PDB Entry: 1eq2 (more details), 2 Å
SCOPe Domain Sequences for d1eq2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eq2d_ c.2.1.2 (D:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty ggrtsdfiesreyekplnvygyskflfdeyvrqilpeansqivgfryfnvygpreghkgs masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt eymawln
Timeline for d1eq2d_: