Lineage for d1htba2 (1htb A:163-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841027Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2841162Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2841181Domain d1htba2: 1htb A:163-338 [29731]
    Other proteins in same PDB: d1htba1, d1htbb1
    complexed with cl, nad, pyz, zn

Details for d1htba2

PDB Entry: 1htb (more details), 2.4 Å

PDB Description: crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c
PDB Compounds: (A:) beta3 alcohol dehydrogenase

SCOPe Domain Sequences for d1htba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htba2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

SCOPe Domain Coordinates for d1htba2:

Click to download the PDB-style file with coordinates for d1htba2.
(The format of our PDB-style files is described here.)

Timeline for d1htba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htba1