Lineage for d1aj2__ (1aj2 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) 
Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein) Protein Dihydropteroate synthetase [51719] (3 species) 
Species Escherichia coli [TaxId:562] [51720] (3 PDB entries) 
Domain d1aj2__: 1aj2 - [29665]
Details for d1aj2__
PDB Entry: 1aj2 (more details), 2 Å
PDB Description: crystal structure of a binary complex of e. coli dihydropteroate synthase
SCOP Domain Sequences for d1aj2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aj2__ c.1.21.1 (-) Dihydropteroate synthetase {Escherichia coli}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye
SCOP Domain Coordinates for d1aj2__:
Click to download the PDB-style file with coordinates for d1aj2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aj2__:
- d1aj2__ appears in SCOP 1.57
- d1aj2__ appears in the current release, SCOPe 2.08, called d1aj2a_
View in 3D