Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Transaldolase [51588] (3 species) probably related to class I aldolases by a circular permutation |
Species Human (Homo sapiens) [TaxId:9606] [51590] (1 PDB entry) |
Domain d1f05b_: 1f05 B: [29174] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1f05 (more details), 2.45 Å
SCOPe Domain Sequences for d1f05b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f05b_ c.1.10.1 (B:) Transaldolase {Human (Homo sapiens) [TaxId: 9606]} mesaldqlkqfttvvadtgdfhaideykpqdattnpslilaaaqmpayqelveeaiaygr klggsqedqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyk eagiskdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfv grildwhvantdkksyepledpgvksvtkiynyykkfsyktivmgasfrntgeikalagc dfltispkllgellqdnaklvpvlsakaaqasdlekihldeksfrwlhnedqmaveklsd girkfaadavklermltermfn
Timeline for d1f05b_: