PDB entry 1f05

View 1f05 on RCSB PDB site
Description: crystal structure of human transaldolase
Class: transferase
Keywords: alpha-beta barrel, TRANSFERASE
Deposited on 2000-05-14, released 2000-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaldolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f05a_
  • Chain 'B':
    Compound: Transaldolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f05b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f05A (A:)
    mssspvkrqrmesaldqlkqfttvvadtgdfhaideykpqdattnpslilaaaqmpayqe
    lveeaiaygrklggsqedqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamva
    rarrlielykeagiskdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacae
    agvtlispfvgrildwhvantdkksyepledpgvksvtkiynyykkfsyktivmgasfrn
    tgeikalagcdfltispkllgellqdnaklvpvlsakaaqasdlekihldeksfrwlhne
    dqmaveklsdgirkfaadavklermltermfnaengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f05A (A:)
    mesaldqlkqfttvvadtgdfhaideykpqdattnpslilaaaqmpayqelveeaiaygr
    klggsqedqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyk
    eagiskdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfv
    grildwhvantdkksyepledpgvksvtkiynyykkfsyktivmgasfrntgeikalagc
    dfltispkllgellqdnaklvpvlsakaaqasdlekihldeksfrwlhnedqmaveklsd
    girkfaadavklermltermfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f05B (B:)
    mssspvkrqrmesaldqlkqfttvvadtgdfhaideykpqdattnpslilaaaqmpayqe
    lveeaiaygrklggsqedqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamva
    rarrlielykeagiskdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacae
    agvtlispfvgrildwhvantdkksyepledpgvksvtkiynyykkfsyktivmgasfrn
    tgeikalagcdfltispkllgellqdnaklvpvlsakaaqasdlekihldeksfrwlhne
    dqmaveklsdgirkfaadavklermltermfnaengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f05B (B:)
    mesaldqlkqfttvvadtgdfhaideykpqdattnpslilaaaqmpayqelveeaiaygr
    klggsqedqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyk
    eagiskdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfv
    grildwhvantdkksyepledpgvksvtkiynyykkfsyktivmgasfrntgeikalagc
    dfltispkllgellqdnaklvpvlsakaaqasdlekihldeksfrwlhnedqmaveklsd
    girkfaadavklermltermfn