SCOPe 2.08: Domain d1f05a_: 1f05 A:

Lineage for d1f05a_ (1f05 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Transaldolase [51588] (3 species)
   probably related to class I aldolases by a circular permutation

7. Species Human (Homo sapiens) [TaxId:9606] [51590] (1 PDB entry)

8. Domain d1f05a_: 1f05 A: [29173]
   has additional insertions and/or extensions that are not grouped together

Details for d1f05a_

PDB Entry: 1f05, 2.45 Å

PDB Description: crystal structure of human transaldolase

PDB Compounds: (A:) Transaldolase

SCOPe Domain Sequences for d1f05a_:

Sequence; same for both SEQRES and ATOM records:

>d1f05a_ c.1.10.1 (A:) Transaldolase {Human (Homo sapiens) [TaxId: 9606]}
mesaldqlkqfttvvadtgdfhaideykpqdattnpslilaaaqmpayqelveeaiaygr
klggsqedqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyk
eagiskdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfv
grildwhvantdkksyepledpgvksvtkiynyykkfsyktivmgasfrntgeikalagc
dfltispkllgellqdnaklvpvlsakaaqasdlekihldeksfrwlhnedqmaveklsd
girkfaadavklermltermfn

Timeline for d1f05a_:

• d1f05a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f05a_ appears in SCOPe 2.07