Lineage for d1fbab_ (1fba B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821887Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 1821888Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [51579] (1 PDB entry)
  8. 1821890Domain d1fbab_: 1fba B: [29121]

Details for d1fbab_

PDB Entry: 1fba (more details), 1.9 Å

PDB Description: the crystal structure of fructose-1,6-bisphosphate aldolase from drosophila melanogaster at 2.5 angstroms resolution
PDB Compounds: (B:) fructose 1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1fbab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbab_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ttyfnypskelqdelreiaqkivapgkgilaadesgptmgkrlqdigventednrrayrq
llfstdpklaenisgvilfhetlyqkaddgtpfaeilkkkgiilgikvdkgvvplfgsed
evttqglddlaarcaqykkdgcdfakwrcvlkigkntpsyqsilenanvlaryasicqsq
rivpivepevlpdgdhdldraqkvtetvlaavykalsdhhvylegtllkpnmvtagqsak
kntpeeialatvqalrrtvpaavtgvtflsggqseeeatvnlsainnvplirpwaltfsy
gralqasvlrawagkkeniaagqnellkrakangdaaqgkyvagsagagsgslfvanhay

SCOPe Domain Coordinates for d1fbab_:

Click to download the PDB-style file with coordinates for d1fbab_.
(The format of our PDB-style files is described here.)

Timeline for d1fbab_: