Lineage for d1qo5a_ (1qo5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821887Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 1821911Species Human (Homo sapiens), liver isozyme [TaxId:9606] [51578] (2 PDB entries)
  8. 1821912Domain d1qo5a_: 1qo5 A: [29102]
    complexed with so4

Details for d1qo5a_

PDB Entry: 1qo5 (more details), 2.5 Å

PDB Description: fructose 1,6-bisphosphate aldolase from human liver tissue
PDB Compounds: (A:) Fructose-bisphosphate aldolase B

SCOPe Domain Sequences for d1qo5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]}
ahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfre
ilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnk
ettiqgldglsercaqykkdgvdfgkwravlriadqcpsslaiqenanalaryasicqqn
glvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghact
kkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfs
ygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslftac

SCOPe Domain Coordinates for d1qo5a_:

Click to download the PDB-style file with coordinates for d1qo5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qo5a_: