Lineage for d1fwdc2 (1fwd C:130-422,C:476-567)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833433Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 2833434Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 2833453Species Klebsiella aerogenes [TaxId:28451] [51562] (28 PDB entries)
  8. 2833458Domain d1fwdc2: 1fwd C:130-422,C:476-567 [29033]
    Other proteins in same PDB: d1fwda_, d1fwdb_, d1fwdc1
    complexed with ni

Details for d1fwdc2

PDB Entry: 1fwd (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 9.4
PDB Compounds: (C:) urease

SCOPe Domain Sequences for d1fwdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwdc2 c.1.9.2 (C:130-422,C:476-567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvahhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOPe Domain Coordinates for d1fwdc2:

Click to download the PDB-style file with coordinates for d1fwdc2.
(The format of our PDB-style files is described here.)

Timeline for d1fwdc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwdc1