Lineage for d1fwdb_ (1fwd B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817976Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2817977Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2817978Protein Urease, beta-subunit [51280] (4 species)
  7. 2818006Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries)
  8. 2818011Domain d1fwdb_: 1fwd B: [28325]
    Other proteins in same PDB: d1fwda_, d1fwdc1, d1fwdc2
    complexed with ni

Details for d1fwdb_

PDB Entry: 1fwd (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 9.4
PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1fwdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwdb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1fwdb_:

Click to download the PDB-style file with coordinates for d1fwdb_.
(The format of our PDB-style files is described here.)

Timeline for d1fwdb_: