Lineage for d1fwda_ (1fwd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928869Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2928870Protein Urease, gamma-subunit [54113] (4 species)
  7. 2928889Species Klebsiella aerogenes [TaxId:28451] [54114] (28 PDB entries)
  8. 2928894Domain d1fwda_: 1fwd A: [37332]
    Other proteins in same PDB: d1fwdb_, d1fwdc1, d1fwdc2
    complexed with ni

Details for d1fwda_

PDB Entry: 1fwd (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 9.4
PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1fwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwda_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOPe Domain Coordinates for d1fwda_:

Click to download the PDB-style file with coordinates for d1fwda_.
(The format of our PDB-style files is described here.)

Timeline for d1fwda_: