Lineage for d2xokh1 (2xok H:12-90)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073725Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2073726Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2073727Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 protein domains)
  6. 2073748Protein automated matches [272490] (2 species)
    not a true protein
  7. 2073749Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311255] (1 PDB entry)
  8. 2073750Domain d2xokh1: 2xok H:12-90 [290234]
    Other proteins in same PDB: d2xokd1, d2xokd2, d2xokd3, d2xoke1, d2xoke2, d2xoke3, d2xokf1, d2xokf2, d2xokf3, d2xokg_, d2xokh2, d2xoki_
    automated match to d2hldh1
    complexed with anp, mg

Details for d2xokh1

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (H:) ATP synthase

SCOPe Domain Sequences for d2xokh1:

Sequence, based on SEQRES records: (download)

>d2xokh1 b.93.1.1 (H:12-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffis
ggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records): (download)

>d2xokh1 b.93.1.1 (H:12-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisgg
fatvqpdsqlcvtaiea

SCOPe Domain Coordinates for d2xokh1:

Click to download the PDB-style file with coordinates for d2xokh1.
(The format of our PDB-style files is described here.)

Timeline for d2xokh1:

  • d2xokh1 is new in SCOPe 2.06-stable