PDB entry 2xok

View 2xok on RCSB PDB site
Description: refined structure of yeast f1c10 ATPase complex to 3 a resolution
Class: hydrolase
Keywords: hydrolase, ATP-binding, f(o), f(1), ATP synthase, mitochondria, inner membrane, transmembrane
Deposited on 2010-08-18, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.21066
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xokd1, d2xokd2, d2xokd3
  • Chain 'E':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xoke1, d2xoke2, d2xoke3
  • Chain 'F':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xokf1, d2xokf2, d2xokf3
  • Chain 'G':
    Compound: ATP synthase subunit gamma, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xokg_
  • Chain 'H':
    Compound: ATP synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xokh1, d2xokh2
  • Chain 'I':
    Compound: ATP synthase catalytic sector f1 epsilon subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xoki_
  • Chain 'K':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ATP synthase subunit 9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xokD (D:)
    mvlprlytatsraafkaakqsapllstswkrcmasaaqstpitgkvtavigaivdvhfeq
    selpailnaleiktpqgklvlevaqhlgentvrtiamdgteglvrgekvldtggpisvpv
    gretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvdllapy
    arggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremketgvi
    nlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrftqagse
    vsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpapattfa
    hldattvlsrgiselgiypavdpldsksrlldaavvgqehydvaskvqetlqtykslqdi
    iailgmdelseqdkltverarkiqrflsqpfavaevftgipgklvrlkdtvasfkavleg
    kydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xokD (D:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xokE (E:)
    mvlprlytatsraafkaakqsapllstswkrcmasaaqstpitgkvtavigaivdvhfeq
    selpailnaleiktpqgklvlevaqhlgentvrtiamdgteglvrgekvldtggpisvpv
    gretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvdllapy
    arggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremketgvi
    nlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrftqagse
    vsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpapattfa
    hldattvlsrgiselgiypavdpldsksrlldaavvgqehydvaskvqetlqtykslqdi
    iailgmdelseqdkltverarkiqrflsqpfavaevftgipgklvrlkdtvasfkavleg
    kydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xokE (E:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xokF (F:)
    mvlprlytatsraafkaakqsapllstswkrcmasaaqstpitgkvtavigaivdvhfeq
    selpailnaleiktpqgklvlevaqhlgentvrtiamdgteglvrgekvldtggpisvpv
    gretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvdllapy
    arggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremketgvi
    nlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrftqagse
    vsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpapattfa
    hldattvlsrgiselgiypavdpldsksrlldaavvgqehydvaskvqetlqtykslqdi
    iailgmdelseqdkltverarkiqrflsqpfavaevftgipgklvrlkdtvasfkavleg
    kydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xokF (F:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2xokG (G:)
    mlsrivsnnatrsvmchqaqvgilyktnpvrtyatlkevemrlksikniekitktmkiva
    strlskaekakisakkmdeaeqlfyknaetknldveatetgapkelivaitsdkglcgsi
    hsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsingigkdaptfqesalia
    dkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqspsfgkfeidtdanvpr
    dlfeytlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnel
    vdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xokG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
    elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
    gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
    psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
    silynrtrqavitnelvdiitgassl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xokH (H:)
    mlrsiigksasrslnfvakrsyaeaaaassglklqfalphetlysgsevtqvnlpaksgr
    igvlanhvptveqllpgvvevmegsnskkffisggfatvqpdsqlcvtaieafplesfsq
    eniknllaeakknvsssdareaaeaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xokH (H:)
    lqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisgg
    fatvqpdsqlcvtaieaplesfseniknllaeakknvsssreaaeaaiqvevlenlqsv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2xokI (I:)
    sawrkagmsyaaylnvaaqairsslktelqtasvtnrsqtdafytqykngtaaseptpmt
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xokI (I:)
    msyaaylnvaaqairsstelqtasvtnrsqtdafytqyknaseptpmtk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.