Lineage for d2xoki_ (2xok I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733879Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 2733880Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)
  6. 2733897Protein automated matches [190373] (2 species)
    not a true protein
  7. 2733898Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311254] (1 PDB entry)
  8. 2733899Domain d2xoki_: 2xok I: [290236]
    Other proteins in same PDB: d2xokd1, d2xokd2, d2xokd3, d2xoke1, d2xoke2, d2xoke3, d2xokf1, d2xokf2, d2xokf3, d2xokg_, d2xokh1, d2xokh2
    automated match to d2hldi_
    complexed with anp, mg

Details for d2xoki_

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (I:) ATP synthase catalytic sector f1 epsilon subunit

SCOPe Domain Sequences for d2xoki_:

Sequence, based on SEQRES records: (download)

>d2xoki_ a.137.8.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msyaaylnvaaqairsslktelqtasvtnrsqtdafytqykngtaaseptpmtk

Sequence, based on observed residues (ATOM records): (download)

>d2xoki_ a.137.8.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msyaaylnvaaqairsstelqtasvtnrsqtdafytqyknaseptpmtk

SCOPe Domain Coordinates for d2xoki_:

Click to download the PDB-style file with coordinates for d2xoki_.
(The format of our PDB-style files is described here.)

Timeline for d2xoki_: