![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) ![]() automatically mapped to Pfam PF04627 |
![]() | Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins) |
![]() | Protein automated matches [190373] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311254] (1 PDB entry) |
![]() | Domain d2xoki_: 2xok I: [290236] Other proteins in same PDB: d2xokd1, d2xokd2, d2xokd3, d2xoke1, d2xoke2, d2xoke3, d2xokf1, d2xokf2, d2xokf3, d2xokg_, d2xokh1, d2xokh2 automated match to d2hldi_ complexed with anp, mg |
PDB Entry: 2xok (more details), 3.01 Å
SCOPe Domain Sequences for d2xoki_:
Sequence, based on SEQRES records: (download)
>d2xoki_ a.137.8.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msyaaylnvaaqairsslktelqtasvtnrsqtdafytqykngtaaseptpmtk
>d2xoki_ a.137.8.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msyaaylnvaaqairsstelqtasvtnrsqtdafytqyknaseptpmtk
Timeline for d2xoki_: