Lineage for d2xokf3 (2xok F:358-476)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717384Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)
  8. 2717429Domain d2xokf3: 2xok F:358-476 [244563]
    Other proteins in same PDB: d2xokd1, d2xokd2, d2xoke1, d2xoke2, d2xokf1, d2xokf2, d2xokg_, d2xokh1, d2xokh2, d2xoki_
    automated match to d2jdid1
    complexed with anp, mg

Details for d2xokf3

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xokf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xokf3 a.69.1.1 (F:358-476) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae

SCOPe Domain Coordinates for d2xokf3:

Click to download the PDB-style file with coordinates for d2xokf3.
(The format of our PDB-style files is described here.)

Timeline for d2xokf3: