Lineage for d2his__ (2his -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.3: beta-glycanases [51487] (12 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Cellulomonas fimi [TaxId:1708] [51520] (8 PDB entries) 
Domain d2his__: 2his - [28918]
Details for d2his__
PDB Entry: 2his (more details), 1.8 Å
PDB Description: cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose
SCOP Domain Sequences for d2his__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2his__ c.1.8.3 (-) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvnaafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqsnlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf
SCOP Domain Coordinates for d2his__:
Click to download the PDB-style file with coordinates for d2his__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2his__:
- d2his__ appears in SCOP 1.57
- d2his__ appears in the current release, SCOPe 2.08, called d2hisa_
View in 3D