Lineage for d1smab3 (1sma B:124-505)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474053Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 474329Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 474356Species Thermus sp. [TaxId:275] [51466] (2 PDB entries)
  8. 474360Domain d1smab3: 1sma B:124-505 [28769]
    Other proteins in same PDB: d1smaa1, d1smaa2, d1smab1, d1smab2

Details for d1smab3

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

SCOP Domain Sequences for d1smab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smab3 c.1.8.1 (B:124-505) Maltogenic amylase, central domain {Thermus sp.}
dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld
yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda
vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp
evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwhdam
pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh
dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn
kelyehvkqlialrkqyralrr

SCOP Domain Coordinates for d1smab3:

Click to download the PDB-style file with coordinates for d1smab3.
(The format of our PDB-style files is described here.)

Timeline for d1smab3: