Lineage for d1smab3 (1sma B:124-505)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18818Protein Maltogenic amylase, central domain [51465] (2 species)
  7. 18822Species Thermus sp. [TaxId:275] [51466] (1 PDB entry)
  8. 18824Domain d1smab3: 1sma B:124-505 [28769]
    Other proteins in same PDB: d1smaa1, d1smaa2, d1smab1, d1smab2

Details for d1smab3

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

SCOP Domain Sequences for d1smab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smab3 c.1.8.1 (B:124-505) Maltogenic amylase, central domain {Thermus sp.}
dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld
yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda
vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp
evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwhdam
pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh
dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn
kelyehvkqlialrkqyralrr

SCOP Domain Coordinates for d1smab3:

Click to download the PDB-style file with coordinates for d1smab3.
(The format of our PDB-style files is described here.)

Timeline for d1smab3: