SCOPe 2.01: Domain d1tmqa2: 1tmq A:1-378

Lineage for d1tmqa2 (1tmq A:1-378)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Animal alpha-amylase [51458] (3 species)
   contains Ca2+-binding subdomain, residues 100-170

7. Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries)

8. Domain d1tmqa2: 1tmq A:1-378 [28762]
   Other proteins in same PDB: d1tmqa1, d1tmqb_
   complexed with ca, cl

Details for d1tmqa2

PDB Entry: 1tmq, 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor

PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1tmqa2:

Sequence; same for both SEQRES and ATOM records:

>d1tmqa2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
ehrwrqvygmvgfrnave

Timeline for d1tmqa2:

• d1tmqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1tmqa2 appears in SCOP 1.75
  
• d1tmqa2 appears in SCOPe 2.02
  
• d1tmqa2 appears in the current release, SCOPe 2.08