Lineage for d1ral__ (1ral -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins) 
Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [51440] (3 PDB entries) 
Domain d1ral__: 1ral - [28698]
Details for d1ral__
PDB Entry: 1ral (more details), 3 Å
PDB Description: three-dimensional structure of rat liver 3alpha-hydroxysteroid(slash)dihydrodiol dehydrogenase: a member of the aldo-keto reductase superfamily
SCOP Domain Sequences for d1ral__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ral__ c.1.7.1 (-) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus)}
mdsislrvalndgnfipvlgfgttvpekvakdevikatkiaidngfrhfdsaylyeveee
vgqairskiedgtvkredifytsklwstfhrpelvrtclektlkstqldyvdlyiihfpm
alqpgdiffprdehgkllfetvdicdtweamekckdaglaksigvsnfncrqlerilnkp
glkykpvcnqvechlylnqskmldyckskdiilvsyctlgssrdktwvdqkspvllddpv
lcaiakkykqtpalvalryqlqrgvvplirsfnakrikeltqvfefqlasedmkaldgln
rnfrynna
SCOP Domain Coordinates for d1ral__:
Click to download the PDB-style file with coordinates for d1ral__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ral__:
- d1ral__ appears in SCOP 1.57
- d1ral__ appears in the current release, SCOPe 2.08, called d1rala_
View in 3D