Lineage for d1dlab_ (1dla B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829201Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2829364Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)
  8. 2829377Domain d1dlab_: 1dla B: [28691]
    CA-atoms only

Details for d1dlab_

PDB Entry: 1dla (more details), 3 Å

PDB Description: novel nadph-binding domain revealed by the crystal structure of aldose reductase
PDB Compounds: (B:) aldose reductase

SCOPe Domain Sequences for d1dlab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlab_ c.1.7.1 (B:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
shlvlytgakmpilglgtwksppgkvteavkvaidlgyrhidcahvyqnenevglglqek
lqgqvvkredlfivsklwctdheknlvkgacqttlrdlkldyldlylihwptgfkpgkdp
fpldgdgnvvpdesdfvetweameelvdeglvkaigvsnfnhlqvekilnkpglkykpav
nqievhpyltqeklieyckskgivvtaysplgspdrpwakpedpslledprikaiaakyn
kttaqvlirfpmqrnlivipksvtperiaenfqvfdfelspedmntllsynrnwrvcalm
scashkdypfheey

SCOPe Domain Coordinates for d1dlab_:

Click to download the PDB-style file with coordinates for d1dlab_.
(The format of our PDB-style files is described here.)

Timeline for d1dlab_: