Lineage for d1dlad_ (1dla D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2080974Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2081106Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)
  8. 2081121Domain d1dlad_: 1dla D: [28693]
    CA-atoms only

Details for d1dlad_

PDB Entry: 1dla (more details), 3 Å

PDB Description: novel nadph-binding domain revealed by the crystal structure of aldose reductase
PDB Compounds: (D:) aldose reductase

SCOPe Domain Sequences for d1dlad_:

Sequence, based on SEQRES records: (download)

>d1dlad_ c.1.7.1 (D:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
shlvlytgakmpilglgtwksppgkvteavkvaidlgyrhidcahvyqnenevglglqek
lqgqvvkredlfivsklwctdheknlvkgacqttlrdlkldyldlylihwptgfkpgkdp
fpldgdgnvvpdesdfvetweameelvdeglvkaigvsnfnhlqvekilnkpglkykpav
nqievhpyltqeklieyckskgivvtaysplgspdrpwakpedpslledprikaiaakyn
kttaqvlirfpmqrnlivipksvtperiaenfqvfdfelspedmntllsynrnwrvcalm
scashkdypfheey

Sequence, based on observed residues (ATOM records): (download)

>d1dlad_ c.1.7.1 (D:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
shlvlytgakmpilglgtwksppgkvteavkvaidlgyrhidcahvyqnenevglglqek
lqgqvvkredlfivsklwctdheknlvkgacqttlrdlkldyldlylihwptgfkpgkdp
fpldgdgnvvpdesdfvetweameelvdeglvkaigvsnfnhlqvekilnkpglkykpav
nqievhpyltqeklieyckskgivvtaysplgspdrpwslledprikaiaakynkttaqv
lirfpmqrnlivipksvtperiaenfqvfdfelspedmntllsynrnwrvcalmscashk
dypfheey

SCOPe Domain Coordinates for d1dlad_:

Click to download the PDB-style file with coordinates for d1dlad_.
(The format of our PDB-style files is described here.)

Timeline for d1dlad_: