![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein Eukaryotic ornithine decarboxylase [51423] (3 species) |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries) Uniprot P07805 |
![]() | Domain d2todd2: 2tod D:44-283 [28654] Other proteins in same PDB: d2toda1, d2todb1, d2todc1, d2todd1 complexed with dmo, plp; mutant |
PDB Entry: 2tod (more details), 2 Å
SCOPe Domain Sequences for d2todd2:
Sequence, based on SEQRES records: (download)
>d2todd2 c.1.6.1 (D:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa
>d2todd2 c.1.6.1 (D:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} dlgdivrkhetwkkclprvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigv ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristlsvkfg akvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhi ldigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa
Timeline for d2todd2: