SCOPe 2.08: Domain d2toda1: 2tod A:37-43,A:284-410

Lineage for d2toda1 (2tod A:37-43,A:284-410)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries)
   Uniprot P07805

8. Domain d2toda1: 2tod A:37-43,A:284-410 [26489]
   Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2
   complexed with dmo, plp; mutant
   missing some secondary structures that made up less than one-third of the common domain

Details for d2toda1

PDB Entry: 2tod, 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d2toda1:

Sequence, based on SEQRES records:

>d2toda1 b.49.2.3 (A:37-43,A:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records):

>d2toda1 b.49.2.3 (A:37-43,A:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
vs

Timeline for d2toda1:

• d2toda1 first appeared (with stable ids) in SCOP 1.55
  
• d2toda1 appears in SCOPe 2.07