Lineage for d1d7ka2 (1d7k A:44-283)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829052Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2829053Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2829104Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 2829105Species Human (Homo sapiens) [TaxId:9606] [51424] (1 PDB entry)
  8. 2829106Domain d1d7ka2: 1d7k A:44-283 [28648]
    Other proteins in same PDB: d1d7ka1, d1d7kb1

Details for d1d7ka2

PDB Entry: 1d7k (more details), 2.1 Å

PDB Description: crystal structure of human ornithine decarboxylase at 2.1 angstroms resolution
PDB Compounds: (A:) human ornithine decarboxylase

SCOPe Domain Sequences for d1d7ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ka2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Human (Homo sapiens) [TaxId: 9606]}
dlgdilkkhlrwlkalprvtpfyavkcndskaivktlaatgtgfdcaskteiqlvqslgv
pperiiyanpckqvsqikyaanngvqmmtfdsevelmkvarahpkaklvlriatddskav
crlsvkfgatlrtsrlllerakelnidvvgvsfhvgsgctdpetfvqaisdarcvfdmga
evgfsmylldigggfpgsedvklkfeeitgvinpaldkyfpsdsgvriiaepgryyvasa

SCOPe Domain Coordinates for d1d7ka2:

Click to download the PDB-style file with coordinates for d1d7ka2.
(The format of our PDB-style files is described here.)

Timeline for d1d7ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d7ka1