Lineage for d1a53a_ (1a53 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827195Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)
  7. 2827199Species Sulfolobus solfataricus [TaxId:2287] [51387] (6 PDB entries)
  8. 2827200Domain d1a53a_: 1a53 A: [28564]
    complexed with igp

Details for d1a53a_

PDB Entry: 1a53 (more details), 2 Å

PDB Description: complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution
PDB Compounds: (A:) indole-3-glycerolphosphate synthase

SCOPe Domain Sequences for d1a53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil

SCOPe Domain Coordinates for d1a53a_:

Click to download the PDB-style file with coordinates for d1a53a_.
(The format of our PDB-style files is described here.)

Timeline for d1a53a_: