SCOPe 2.07: Domain d1a53a_: 1a53 A:

Lineage for d1a53a_ (1a53 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [51387] (6 PDB entries)

8. Domain d1a53a_: 1a53 A: [28564]
   complexed with igp

Details for d1a53a_

PDB Entry: 1a53, 2 Å

PDB Description: complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution

PDB Compounds: (A:) indole-3-glycerolphosphate synthase

SCOPe Domain Sequences for d1a53a_:

Sequence; same for both SEQRES and ATOM records:

>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil

Timeline for d1a53a_:

• d1a53a_ first appeared (with stable ids) in SCOP 1.55, called d1a53__
  
• d1a53a_ appears in SCOPe 2.06
  
• d1a53a_ appears in the current release, SCOPe 2.08