Lineage for d1a53__ (1a53 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) 
Protein Indole-3-glycerophosphate synthase, IPGS [51385] (2 species) Species Sulfolobus solfataricus [TaxId:2287] [51387] (4 PDB entries) 
Domain d1a53__: 1a53 - [28564]
Details for d1a53__
PDB Entry: 1a53 (more details), 2 Å
PDB Description: complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution
SCOP Domain Sequences for d1a53__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a53__ c.1.2.4 (-) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil
SCOP Domain Coordinates for d1a53__:
Click to download the PDB-style file with coordinates for d1a53__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a53__:
- d1a53__ appears in SCOP 1.57
- d1a53__ appears in the current release, SCOPe 2.08, called d1a53a_
View in 3D