PDB entry 1a53

View 1a53 on RCSB PDB site
Description: complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution
Class: synthase
Keywords: synthase, thermostable, tim-barrel
Deposited on 1998-02-19, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerolphosphate synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: TRPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a53a_
  • Heterogens: IGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a53A (A:)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
    verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
    aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
    rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
    kikefil