Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) |
Family c.1.2.3: Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51375] (1 protein) |
Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species) |
Species Escherichia coli [TaxId:562] [51378] (1 PDB entry) |
Domain d1eixd_: 1eix D: [28545] |
PDB Entry: 1eix (more details), 2.5 Å
SCOP Domain Sequences for d1eixd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eixd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli} vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq
Timeline for d1eixd_: