Lineage for d1duna_ (1dun A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560651Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1560721Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1560722Species Equine infectious anemia virus [TaxId:11665] [51288] (2 PDB entries)
  8. 1560723Domain d1duna_: 1dun A: [28371]

Details for d1duna_

PDB Entry: 1dun (more details), 1.9 Å

PDB Description: eiav dutpase native
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleoditohydrolase

SCOPe Domain Sequences for d1duna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]}
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki

SCOPe Domain Coordinates for d1duna_:

Click to download the PDB-style file with coordinates for d1duna_.
(The format of our PDB-style files is described here.)

Timeline for d1duna_: