Lineage for d1dun__ (1dun -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) 
Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species) 
Species Equine infectious anemia virus [TaxId:11665] [51288] (2 PDB entries) 
Domain d1dun__: 1dun - [28371]
Details for d1dun__
PDB Entry: 1dun (more details), 1.9 Å
PDB Description: eiav dutpase native
SCOP Domain Sequences for d1dun__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dun__ b.85.4.1 (-) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus}
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki
SCOP Domain Coordinates for d1dun__:
Click to download the PDB-style file with coordinates for d1dun__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dun__:
- d1dun__ appears in SCOP 1.57
- d1dun__ appears in the current release, SCOPe 2.08, called d1duna_
View in 3D