Lineage for d1f7qb_ (1f7q B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18112Fold b.85: beta-clip [51268] (5 superfamilies)
  4. 18196Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) (S)
  5. 18197Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein)
  6. 18198Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species)
  7. 18207Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 18224Domain d1f7qb_: 1f7q B: [28369]

Details for d1f7qb_

PDB Entry: 1f7q (more details), 2.26 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.

SCOP Domain Sequences for d1f7qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7qb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv

SCOP Domain Coordinates for d1f7qb_:

Click to download the PDB-style file with coordinates for d1f7qb_.
(The format of our PDB-style files is described here.)

Timeline for d1f7qb_: